PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do012258.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 363aa    MW: 37102 Da    PI: 9.4725
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do012258.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.94.6e-3869126360
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                 ++ l+cprC+s+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk + 
  Do012258.1  69 QAPLRCPRCNSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKPRP 126
                 66789**************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.9E-3271125IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.09672126IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-2672123IPR003851Zinc finger, Dof-type
PROSITE patternPS01361074110IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MDQLKSVNDG NPASLPLLLH PIVSNPSPTS SSSTSSRSSA QQQQQRSTSA TSSPQGQGQG  60
QHQGQGAEQA PLRCPRCNSS NTKFCYYNNY NLTQPRHFCK TCRRYWTKGG ALRNVPIGGG  120
CRKPRPMPAP VVKPAVSCKG VGGAPSLGLG VGLGMGAGPV PWAPSQQAAA AQLMALLNSA  180
RGVQGGHGGS NMHRLLGLDT MPHLPLQVLP GAGNAGGAPG SLWPPAAPRP IPTPPHMDSQ  240
LGMGPLGLGQ HDVLSSLGLK LPPPSSSPAA SYYSDQLHAV VSSAAGGRPH EYDAPGATSL  300
PCTSAVTSLP PSVSSISAAL SSATVGLDLP VVSITVPEMQ YWPGPAAMSV AWPDLPTPNG  360
AFP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269760.0KJ726976.1 Zea mays clone pUT3677 C2C2-DOF transcription factor (DOF25) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981654.11e-171PREDICTED: uncharacterized protein LOC101786956
TrEMBLK4ALA51e-171K4ALA5_SETIT; Uncharacterized protein
STRINGSi039685m1e-170(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77103144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.12e-31Dof family protein